Effector profile
PlantPEAD ID: PlantPEAD22881 Uniprot ID: A0A1H0DRZ6 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 219572 Pathogen type: Bacteria
Species: Pseudomonas antarctica Strain: BS2772 Other name:
Gene name: NCBI Gene ID: LT629704
Entry name: A0A1H0DRZ6_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MTAARLLLPLSLALLAACASAPKQNVTVENQSACPLQLKSGQNLTLTLPSNPTTGYRWAIQDSAGGVLRALSPEVYSSTESGVIGGGGQSTWRFQAFAAGQGRLRLTSQQPWEPEAEPAETFDCAITVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13576.3 129 5.29 -0.095 62.95
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.