Effector profile
PlantPEAD ID: PlantPEAD22889 Uniprot ID: A0A1H5I092 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 191390 Pathogen type: Bacteria
Species: Pseudomonas palleroniana Strain: BS3265 Other name:
Gene name: NCBI Gene ID: CP025494
Entry name: A0A1H5I092_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MTAARLLLPLSFALLAACASAPKQNVTVDSQSACPLQLKSGQNLILTLPSNPTTGYRWAIQDSAGGVLRALSPEVYSSAESGVIGGGGQSTWRFQAFAAGQGRLRLTSQQPWEPEAEPTETFDCAITVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13581.3 129 5.25 -0.042 65.36
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.