Effector profile
PlantPEAD ID: PlantPEAD22890 Uniprot ID: A0A1H5JY68 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 1605838 Pathogen type: Bacteria
Species: Pseudomonas coleopterorum Strain: LMG 28558 Other name:
Gene name: NCBI Gene ID: FNTZ01000001
Entry name: A0A1H5JY68_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSVVRLILPASLTLLTACAQQPRHNIELEDQSQCPVALSVGQTITLQLPTNPSTGYRWLVQNPGASVLRSLGPEVYSSARETGVVGAAGQSTWRFQARAPGDGHLMLVLQQPWAPEVPPAETFSCDITVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13962.9 130 5.53 -0.015 72.75
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.