Effector profile
| PlantPEAD ID: PlantPEAD22891 | Uniprot ID: A0A1H6MV25 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 50340 | Pathogen type: Bacteria |
| Species: Pseudomonas fuscovaginae | Strain: LMG 2158 | Other name: |
| Gene name: | NCBI Gene ID: LT629972 | |
| Entry name: A0A1H6MV25_9PSED | Protein name: Inhibitor of cysteine peptidase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MTATRLLLPLSLVLLTACAQQPRQNVTLENQSECPMQLKTGQNMILSLPSNPTTGYRWTIQDSAGGVLKSLGPEVYHNPENSDVIGAAGQSTWRFQAFASGTGRLRLTYQQPWEPEVPPAESFDCPIVVN
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 14243.2 | 130 | 5.24 | -0.267 | 52.23 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR036331,IPR018990
Pfam: PF09394
SMART:
KEGG:
PRINTS: