Effector profile
PlantPEAD ID: PlantPEAD22891 Uniprot ID: A0A1H6MV25 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 50340 Pathogen type: Bacteria
Species: Pseudomonas fuscovaginae Strain: LMG 2158 Other name:
Gene name: NCBI Gene ID: LT629972
Entry name: A0A1H6MV25_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MTATRLLLPLSLVLLTACAQQPRQNVTLENQSECPMQLKTGQNMILSLPSNPTTGYRWTIQDSAGGVLKSLGPEVYHNPENSDVIGAAGQSTWRFQAFASGTGRLRLTYQQPWEPEVPPAESFDCPIVVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14243.2 130 5.24 -0.267 52.23
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.