Effector profile
PlantPEAD ID: PlantPEAD22892 Uniprot ID: A0A1H9P0Q8 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 286 Pathogen type: Bacteria
Species: Pseudomonas Strain: sp. NFACC02 Other name:
Gene name: NCBI Gene ID: FOEO01000029
Entry name: A0A1H9P0Q8_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MTPARLLVPLSLALLAACAQQPKQIVSLDDQKDCPITLKTGQTLMLMLPSNPTTGHRWLMQNPAPSILNAMGPEVFNTPEEVGMVGTEGQSVWRYKAANPGTGHLMMVYQQPWAPEVRPERTFDCAITVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14271.6 130 6.05 -0.135 46.56
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.