Effector profile
PlantPEAD ID: PlantPEAD22905 Uniprot ID: A0A231GJ44 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 77298 Pathogen type: Bacteria
Species: Pseudomonas jessenii Strain: BS3660 Other name:
Gene name: NCBI Gene ID: FNTC01000002
Entry name: A0A231GJ44_PSEJE Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSPIRLLVPLALALLAACATQPKQNVTVEKQSECPVKLTNGQNLILTLPSNPTTGYRWAIQDSAGGVLHTLGPEVYRNPEDAGIVGAAGVSTWRFQAFATGTGRLRLTSQQPWAPEVLPVDSFDCAISVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13855.9 130 6.54 0.041 50.53
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.