Effector profile
| PlantPEAD ID: PlantPEAD22905 | Uniprot ID: A0A231GJ44 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 77298 | Pathogen type: Bacteria |
| Species: Pseudomonas jessenii | Strain: BS3660 | Other name: |
| Gene name: | NCBI Gene ID: FNTC01000002 | |
| Entry name: A0A231GJ44_PSEJE | Protein name: Inhibitor of cysteine peptidase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSPIRLLVPLALALLAACATQPKQNVTVEKQSECPVKLTNGQNLILTLPSNPTTGYRWAIQDSAGGVLHTLGPEVYRNPEDAGIVGAAGVSTWRFQAFATGTGRLRLTSQQPWAPEVLPVDSFDCAISVN
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 13855.9 | 130 | 6.54 | 0.041 | 50.53 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR036331,IPR018990
Pfam: PF09394
SMART:
KEGG:
PRINTS: