Effector profile
PlantPEAD ID: PlantPEAD22919 Uniprot ID: A0A2N0DI72 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 674054 Pathogen type: Bacteria
Species: Pseudomonas baetica Strain: LMG 25716 Other name:
Gene name: NCBI Gene ID: NONE
Entry name: A0A2N0DI72_9PSED Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSPTRLFVPLALSLLAACATQPKHNVTVEKQSECPVQLSNGQNLIVTLPSNPTTGYRWAIQDSAGGVLRALSPEVYSNPEDAGVVGAAGVSTWRFQAFAPGTGRLRLTSQQPWAPEVLPVETFDCAISVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13834.7 130 5.7 0.007 59.63
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.