Effector profile
| PlantPEAD ID: PlantPEAD23912 | Uniprot ID: A0A0W8CW89 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: race 0 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: NONE | |
| Entry name: A0A0W8CW89_PHYNI | Protein name: NPP1 protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MDRVSVSVLYFVLLSAVSATTISHDSVQPFVQPDPVTISEKTAVKFKPQLHVEKGCVPFPAVNAAGEITEGLKGWIWSEDCSVAPLGSQMYGRSTWFQDKWAMVYAWYFPTGFAAGGAEIRHYWSSMVMWIDNPALETPKILGASLSQQLLEPRGYLLGFLTPQRKDPYDKYISIPPVSFVGAQPVSSRRISRWRVEYTYSGGSNVSTKVSHRYANKGDWLALVFSAREGQYHDLIMWDQLTDEARAALNSVDFGESKVPFNDQNFQSTLEKAYPF
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 31014.2 | 276 | 6.22 | -0.207 | 40.82 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: