Effector profile
| PlantPEAD ID: PlantPEAD25564 | Uniprot ID: W2GLQ3 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: CJ02B3 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: KI687042 | |
| Entry name: W2GLQ3_PHYPR | Protein name: Ubiquitin-like protease family profile domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
TCAGTCCATCTCCAGGCTGGTGGCCACGGCGTTAGCTGCGTTCGTGTACTGCGCTTGGTTGAGAGGATCATAGTAGTATATACGCTTTTTCTCCACTTTGACGACCACACAGCACCAGTGGTAGTTTGAAAAGTTCAACGGCAGCATGACGGTATCCACTCCATCTTCATTCACTTGCTGTAGCACACGACCACGTGTTGCGTCGTCAAGGCAGCGCTCGCCAGGATTACGCGTTCTCTTGCCCTTCGTAAATGCTGCCTGGAATCCAGCGAAACGTAATCCTGGACTAGACGTATACACAATCCATTTGATCAT
Protein sequence:
MIKWIVYTSSPGLRFAGFQAAFTKGKRTRNPGERCLDDATRGRVLQQVNEDGVDTVMLPLNFSNYHWCCVVVKVEKKRIYYYDPLNQAQYTNAANAVATSLEMD
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 11856.5 | 104 | 8.84 | -0.374 | 24.17 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR038765,IPR003653
Pfam: PF02902
SMART:
KEGG:
PRINTS: