Effector profile
PlantPEAD ID: PlantPEAD26425 Uniprot ID: C9S5S5 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 1051613 Pathogen type: Fungi
Species: Verticillium alfalfae Strain: strain VaMs.102 / ATCC MYA-4576 / FGSC 10136 Other name: Verticillium wilt of alfalfa,Verticillium albo-atrum
Gene name: NCBI Gene ID: DS985214
Entry name: C9S5S5_VERA1 Protein name: RlpA-like protein double-psi beta-barrel domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
ATGGGCACGCAGTCCAACGGCAACCCCATGTGCGACCAGACCATCACCATCAGCGCCAACGGCAAGGAAGTTGTTTGCACTGTCCGCGACAAGTGCATGGGCTGCGAGCCCGAGGCCATCGACGTGTCCAAGGCCGCCTTCCTCGAGCTCTTCGGCTCGCTGACTGCTGGTCGCACTGAGGTCAAGTGGTGGTTCAACTAA
Protein sequence:
MGTQSNGNPMCDQTITISANGKEVVCTVRDKCMGCEPEAIDVSKAAFLELFGSLTAGRTEVKWWFN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
7188.2 66 4.81 -0.142 24.92
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.