Effector profile
| PlantPEAD ID: PlantPEAD26600 | Uniprot ID: C9SCF4 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 1051613 | Pathogen type: Fungi |
| Species: Verticillium alfalfae | Strain: strain VaMs.102 / ATCC MYA-4576 / FGSC 10136 | Other name: Verticillium wilt of alfalfa,Verticillium albo-atrum |
| Gene name: | NCBI Gene ID: DS985216 | |
| Entry name: C9SCF4_VERA1 | Protein name: Endo-1,4-beta-xylanase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MVTFKSLLLAASALTAVLGRPFDNFDGPDVNITDAGELLERRQVTANSEGTHNGYFYSWWSDGGGQVTYTMGAGSRYSVTWKDTGNFVGGKGWNPGTGRTINYGGSFSPQGNGYLAVYGWTRNPLIEYYVVESYGTYNPGSGGQLKGTVTTDGGTYNVYVSTRTNQPSIDGTRTFQQYWSVRTSKRVGGAVTMQNHFNAWAQFGMNLGSHYYQIVATEGYQSSGSSDIYVQTQCKSPWDSGR
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 26433.9 | 242 | 7.77 | -0.529 | 23.88 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR013320,IPR013319,IPR018208,IPR033119,IPR033123,IPR001137
Pfam: PF00457
SMART:
KEGG: val:VDBG_02878
PRINTS: PR00911