Effector profile
PlantPEAD ID: PlantPEAD27039 Uniprot ID: A0A2N1L3A2 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 5544 Pathogen type: Fungi
Species: Trichoderma harzianum Strain: Other name: Hypocrea lixii
Gene name: NCBI Gene ID: NONE
Entry name: A0A2N1L3A2_TRIHA Protein name: Prion-inhibition and propagation HeLo domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MANPAVALFEAMSLATSLPATFISIVECFEYVELGRRFGKDFNKCQARLEALKLQITRWGISSGVLPDPETGKQRVVSFDAHTTETAQKLLDFILADTRELENKSRKYCDQPGVTSEINSMQPDLIDEPTQALKSITSKIFSQRIQGVALQKKTIWALRDKKQFDRLLEDITENLNLLVLMQQVTEPQRELLSFPPTSTGTPPFRCLTTKNSYPFN
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
24418 216 6.62 -0.312 42.48
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.