Effector profile
| PlantPEAD ID: PlantPEAD27050 | Uniprot ID: A0A6G1NNH0 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 27337 | Pathogen type: Fungi |
| Species: Verticillium dahliae | Strain: | Other name: Verticillium wilt |
| Gene name: | NCBI Gene ID: NONE | |
| Entry name: A0A6G1NNH0_VERDA | Protein name: Prion-inhibition and propagation HeLo domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MEAAGFAIGLVGLAGLFSSCIEAVARAHSYKSFSSDSQALDLQFSAAKLRLETWGPAVGFAGAGAIAAAGDERRGPAPSPGA
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 8154.18 | 82 | 5.62 | 0.291 | 44.37 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR029498,IPR038305
Pfam: PF14479
SMART:
KEGG:
PRINTS: