Effector profile
PlantPEAD ID: PlantPEAD27050 Uniprot ID: A0A6G1NNH0 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 27337 Pathogen type: Fungi
Species: Verticillium dahliae Strain: Other name: Verticillium wilt
Gene name: NCBI Gene ID: NONE
Entry name: A0A6G1NNH0_VERDA Protein name: Prion-inhibition and propagation HeLo domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MEAAGFAIGLVGLAGLFSSCIEAVARAHSYKSFSSDSQALDLQFSAAKLRLETWGPAVGFAGAGAIAAAGDERRGPAPSPGA
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
8154.18 82 5.62 0.291 44.37
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.