Effector profile
| PlantPEAD ID: PlantPEAD27503 | Uniprot ID: A0A8T1WZV0 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 109152 | Pathogen type: Oomycota |
| Species: Phytophthora boehmeriae | Strain: SCRP23 | Other name: |
| Gene name: TMEFF1_3 | NCBI Gene ID: JAGDFL010000053 | |
| Entry name: A0A8T1WZV0_9STRA | Protein name: Transmembrane protein with EGF-like and two follistatin-like domains 1 | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKFATCLVLVTVAIASATADDCSFGCTNVYDPVTDENGKTYSNECYMRLAKCQEGKIAPPSSAIPATTEPASSPSMWTDYGDCPDNCLDVYKPVTDENGKTYSNDCYMRQAKCKDN
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 12624.1 | 116 | 4.42 | -0.464 | 41.33 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR002350
Pfam: PF07648
SMART: SM00280
KEGG:
PRINTS: