Effector profile
PlantPEAD ID: PlantPEAD27503 Uniprot ID: A0A8T1WZV0 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 109152 Pathogen type: Oomycota
Species: Phytophthora boehmeriae Strain: SCRP23 Other name:
Gene name: TMEFF1_3 NCBI Gene ID: JAGDFL010000053
Entry name: A0A8T1WZV0_9STRA Protein name: Transmembrane protein with EGF-like and two follistatin-like domains 1
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKFATCLVLVTVAIASATADDCSFGCTNVYDPVTDENGKTYSNECYMRLAKCQEGKIAPPSSAIPATTEPASSPSMWTDYGDCPDNCLDVYKPVTDENGKTYSNDCYMRQAKCKDN
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
12624.1 116 4.42 -0.464 41.33
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.