Effector profile
| PlantPEAD ID: PlantPEAD27996 | Uniprot ID: W2JS97 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: CJ05E6 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: KI670635 | |
| Entry name: W2JS97_PHYPR | Protein name: Crinkler effector protein N-terminal domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAEANMKLRCGVYGEGSVFSVEITLDAKVSALQEKIAGILSTEQHTVPPRLLTLYLARKKGETTWMKHDHTVIDFLRSGTSTEYEEMRSSSRLKKKELLGSSFTPGDEEIQVLVALPPDQAAVTMVDRGWTAKWVNEFRKNQLAPHQLPRLGELADFIDNELPGKITLHQEIYDTWITKMTSQSPELMAKLFKIDNLKQCVNFLFRIGSRIVYATDPGDTKKSFISFWDDLIRNVLNFVLHDIGKSVRNSSRSASTGSNRPDYLFIVDSVCVFCGEEKAPGEQLETPRRELVEKLVWSYGDAPYLFGYAAVGYEAR
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 35723.8 | 316 | 6.13 | -0.306 | 31.24 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR045379
Pfam: PF20147
SMART:
KEGG:
PRINTS: