Effector profile
| PlantPEAD ID: PlantPEAD28117 | Uniprot ID: A0A0W8CXC3 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: race 0 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: NONE | |
| Entry name: A0A0W8CXC3_PHYNI | Protein name: RxLR effector protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRLLLWVLLATLITFISSSHAVSAVADSDEPKVTQLTMKDIDIVTRLLFVEDGDAAKRFLRGNAKQDLTTANNDLDANDEERGLIPSTLTNLITKAKNGWAKWKANALEKAFQHMMKLGETPTSLAKRLEIGGAAELRYEKLYEKYTAWWINYHTVAGT
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 17825.5 | 159 | 6.84 | -0.226 | 20.29 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR031825
Pfam: PF16810
SMART:
KEGG:
PRINTS: