Effector profile
PlantPEAD ID: PlantPEAD28117 Uniprot ID: A0A0W8CXC3 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 4790 Pathogen type: Oomycota
Species: Phytophthora nicotianae Strain: race 0 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: NONE
Entry name: A0A0W8CXC3_PHYNI Protein name: RxLR effector protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRLLLWVLLATLITFISSSHAVSAVADSDEPKVTQLTMKDIDIVTRLLFVEDGDAAKRFLRGNAKQDLTTANNDLDANDEERGLIPSTLTNLITKAKNGWAKWKANALEKAFQHMMKLGETPTSLAKRLEIGGAAELRYEKLYEKYTAWWINYHTVAGT
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
17825.5 159 6.84 -0.226 20.29
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.