Effector profile
| PlantPEAD ID: PlantPEAD28489 | Uniprot ID: Q9AUI8 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: AF130855 | |
| Entry name: Q9AUI8_PHYPR | Protein name: Reverse transcriptase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
ACGGCGTTCCTGCACGGCTGGCTGGACGAAGACATCTACATGGTGCAGCCGGACGGCTACGTTGACGAGGCGCACCCGGAATTCGTGTGCAAGCTCAAGCGTTCGCTTTACGGCCTCAAGCAGTCGCCGCGAATGTGGAACCAGACCATCGACAAGTTCATGCTGGAGCTGGGGTTCAAGAAGTGTGAGGCGGATCACTGCATCTACGTTAAGCGTGATGACCAAGACATGATCTTCGTGGCGCTGTACGTGGACGACATGCT
Protein sequence:
TAFLHGWLDEDIYMVQPDGYVDEAHPEFVCKLKRSLYGLKQSPRMWNQTIDKFMLELGFKKCEADHCIYVKRDDQDMIFVALYVDDML
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 10469.1 | 88 | 4.81 | -0.295 | 35.46 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR043502,IPR013103
Pfam: PF07727
SMART:
KEGG:
PRINTS: