Effector profile
| PlantPEAD ID: PlantPEAD29732 | Uniprot ID: A0A0W8DZK3 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: race 0 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: NONE | |
| Entry name: A0A0W8DZK3_PHYNI | Protein name: 3-hydroxyisobutyrate dehydrogenase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MIFARSIALFAGLALASTVQGATILGGYTQKNATSDDIELLTQAASNASTYNEDVDTRICLIAIENLETQTVAGTNYKFQVAGCTVDTDEELGACDDRNCEYSSYDIIIFSQPWTDTLEVTSITLVE
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 13720.2 | 127 | 3.81 | 0.071 | 27.6 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR000010,IPR046350
Pfam:
SMART:
KEGG:
PRINTS: