Effector profile
PlantPEAD ID: PlantPEAD30056 Uniprot ID: A0A080ZL82 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: P1976 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: ANJA01002899
Entry name: A0A080ZL82_PHYPR Protein name: RxLR effector protein
DOI:
Gene/Protein information
Gene sequence:
CTAGCTGCTGATGACGCAGATCTCGTTGTGTTTGGCGTCTTGATAGCGTGTTAGACATTCGTCCACGTCTCCCTCTGGTTCAGGCCACGTCTCTAGCGACAGTGCGAGCTCTCGCCTTCCTTCCCACCACCGCAGTACGTCACGCAGCTGTCGCCACTCGAATGCACTTGACGCACTGAGCTTCGATGCTCCCAGCGAGACGTCTCCACCGAGCAACGACCACACTGAAGACCCAGAGATCAGCAGCAGCCACGGCAGAATTGCCACGCACAGCAACACGATGCGCAT
Protein sequence:
MRIVLLCVAILPWLLLISGSSVWSLLGGDVSLGASKLSASSAFEWRQLRDVLRWWEGRRELALSLETWPEPEGDVDECLTRYQDAKHNEICVISS
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
10729.3 95 4.84 0.129 48.75
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.