Effector profile
PlantPEAD ID: PlantPEAD30383 Uniprot ID: W2NSC7 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: IAC_01/95 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: KI691810
Entry name: W2NSC7_PHYPR Protein name: Uncharacterized protein
DOI:
Gene/Protein information
Gene sequence:
ATGACGAGCTCTGTGTTCCCGACATTCCACAAACACAAGATGTCTCCCGCGGATGTCGAAGATCTTCTCGTTAAACTCCTCGTGAATTCTAAAAAAAGCGCTTGA
Protein sequence:
MTSSVFPTFHKHKMSPADVEDLLVKLLVNSKKSA
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
3786.46 34 9.4 -0.103 78.67
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.