Effector profile
PlantPEAD ID: PlantPEAD32268 Uniprot ID: A0A366NS20 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 405761 Pathogen type: Fungi
Species: Gibberella moniliformis Strain: Other name: Maize ear and stalk rot fungus,Fusarium verticillioides
Gene name: NCBI Gene ID: NONE
Entry name: A0A366NS20_GIBMO Protein name: Uncharacterized protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MEDAVQAFINARPATLELARNADTDKTSSKRKAVQDHHESGDAPDGKRLRSSTRLRNTRSHPSYTVPTEEDETVQVSEGDEEFQPEPGEFSGVKAFFYPNDRQRTALSRAQFAKVE
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13039.2 116 5.39 -1.103 58.34
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.