Effector profile
| PlantPEAD ID: PlantPEAD32843 | Uniprot ID: C9SQM7 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 1051613 | Pathogen type: Fungi |
| Species: Verticillium alfalfae | Strain: strain VaMs.102 / ATCC MYA-4576 / FGSC 10136 | Other name: Verticillium wilt of alfalfa,Verticillium albo-atrum |
| Gene name: | NCBI Gene ID: DS985222 | |
| Entry name: C9SQM7_VERA1 | Protein name: Tyrosinase copper-binding domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSSDGSKVPHAGYPWAGYNIPPGDGGGCIMEGPFKDFKVNLGPLVPFLPDLPANPRPDGLGYNPRCLRRDINRVAANFSNEQYTYDLITKETDIYSFQTVMQGDFNSLNIGVHGGGHFMIGGDPGGDFYISPGDPSFYLHHAMIDRVWWIWQLRNLDARLDAVAGLTFPSDGSGVKNGTLDDPVDLNVNGKEYRLGDLLDTMNGPFCYIYV
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 23212.1 | 211 | 4.71 | -0.318 | 32.15 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008922,IPR002227
Pfam: PF00264
SMART:
KEGG: val:VDBG_07262
PRINTS: