Effector profile
PlantPEAD ID: PlantPEAD33665 Uniprot ID: A0A0M1K7Q1 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 347 Pathogen type: Bacteria
Species: Xanthomonas oryzae Strain: X11-5A Other name:
Gene name: NCBI Gene ID: NONE
Entry name: A0A0M1K7Q1_9XANT Protein name: Elicitor of hypersensitive response HpaG
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNSLNTQFGGSASNFQLDQGQNVQFGSYQGNQGNQGNQGISEKQMDQLLCQLISALLQPSKNAEDGQGQGQGGDNGGSQGSQHNGPSPYTQMLMHIVGEILQAQNGGCAGGDGGGGFGGGFGGDFGGGLGSSLSSDSGSMQ
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14079 141 4.03 -0.654 41.01
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.