Effector profile
PlantPEAD ID: PlantPEAD33678 Uniprot ID: A0A3G2WHB9 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 53413 Pathogen type: Bacteria
Species: Xanthomonas axonopodis Strain: pv. commiphoreae strain LMG26789 Other name:
Gene name: NCBI Gene ID: NONE
Entry name: A0A3G2WHB9_9XANT Protein name: Elicitor of hypersensitive response HpaG
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNSLNTQIGANSSFLQVDPSQNSQPGSNQGQGISEKQLDQLLTQLIMALLQQSNNADQGQGQGGDSGGQGGNSQQAGQPNGSPSPYTQMLMNIVGDILQSQNGGGFGGGFGGGFGGGLGTSLASDTGSMQ
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
12963.9 130 3.53 -0.576 53.66
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.