Effector profile
| PlantPEAD ID: PlantPEAD35765 | Uniprot ID: A0A225UEM2 | Source: Orthologous | 
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4795 | Pathogen type: Oomycota | 
| Species: Phytophthora megakarya | Strain: zdho120 | Other name: | 
| Gene name: | NCBI Gene ID: NBNE01020210 | |
| Entry name: A0A225UEM2_9STRA | Protein name: PcF and SCR74-like cys-rich secreted peptide | |
| DOI: | ||
Gene/Protein information
Gene sequence:
CTATCTGCATGGAGTGCCAATGTTGCAACTGAGACGGCAGCATTCGTTGAAATCGCCCCTTGGTTGACTTGCGCAGCACTTGCTGACACGCAGATTGTCTTCAGAATAAAGAACCGCGCACCCTCGAGCCCCACAATATTGCTGAGCAGTTGCGGCAGTTGCGATCAT
                Protein sequence:
MIATAATAQQYCGARGCAVLYSEDNLRVSKCCASQPRGDFNECCRLSCNIGTPCR
            Loading ...
                
            Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index | 
|---|---|---|---|---|
| 5907.75 | 55 | 8.17 | -0.145 | 41.08 | 
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: | 
| Host classification: | NCBI Species: | 
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence | 
|---|
No Record found.
                    External Links
Interpro: IPR018570
        Pfam: PF09461
        SMART: 
        KEGG: 
        PRINTS: