Effector profile
PlantPEAD ID: PlantPEAD35767 Uniprot ID: A0A225VHA7 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 4795 Pathogen type: Oomycota
Species: Phytophthora megakarya Strain: zdho120 Other name:
Gene name: NCBI Gene ID: NBNE01005115
Entry name: A0A225VHA7_9STRA Protein name: PcF and SCR74-like cys-rich secreted peptide
DOI:
Gene/Protein information
Gene sequence:
GCTCCAGGATGTGCGTCGCGTTTTTCTGATTTCAACATACGTACCAGCGCGTGCTGCAAAAAGCAACCAGACAATTTCGATGATTGCTGCCGTATGAGCTGCAACTCGGGCAGCCCCTGCTAG
Protein sequence:
APGCASRFSDFNIRTSACCKKQPDNFDDCCRMSCNSGSPC
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
4323.84 40 7.77 -0.568 75.88
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.