Effector profile
PlantPEAD ID: PlantPEAD35767 | Uniprot ID: A0A225VHA7 | Source: Orthologous |
Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4795 | Pathogen type: Oomycota |
Species: Phytophthora megakarya | Strain: zdho120 | Other name: |
Gene name: | NCBI Gene ID: NBNE01005115 | |
Entry name: A0A225VHA7_9STRA | Protein name: PcF and SCR74-like cys-rich secreted peptide | |
DOI: |
Gene/Protein information
Gene sequence:
GCTCCAGGATGTGCGTCGCGTTTTTCTGATTTCAACATACGTACCAGCGCGTGCTGCAAAAAGCAACCAGACAATTTCGATGATTGCTGCCGTATGAGCTGCAACTCGGGCAGCCCCTGCTAG
Protein sequence:
APGCASRFSDFNIRTSACCKKQPDNFDDCCRMSCNSGSPC
Loading ...
Main properties of effector
Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
---|---|---|---|---|
4323.84 | 40 | 7.77 | -0.568 | 75.88 |
Plant infestation information
Experimental plant: | |
Susceptible plant: | Disease name: |
Host classification: | NCBI Species: |
Pathogen-plant protein interaction
Uniprot ID | Protein name | Gene name | Species | Protein sequence |
---|
No Record found.
External Links
Interpro: IPR018570
Pfam: PF09461
SMART:
KEGG:
PRINTS: