Effector profile
| PlantPEAD ID: PlantPEAD35770 | Uniprot ID: A0A225WJL5 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4795 | Pathogen type: Oomycota |
| Species: Phytophthora megakarya | Strain: zdho120 | Other name: |
| Gene name: | NCBI Gene ID: NBNE01000752 | |
| Entry name: A0A225WJL5_9STRA | Protein name: PcF and SCR74-like cys-rich secreted peptide | |
| DOI: | ||
Gene/Protein information
Gene sequence:
CTAGCATGGGCTGCCAAAGTTGCAACTGGAATAACAGCACTCGTGGAAATTGCCTGGTCGCTTTGCGCAGCACGCGCTGGTACGTATGTTGGAATCAGAATAAAGAGCTGCACATCCTTGAGCCGAACAGAGTTGTTGTTGAGCATTTGAAGTAGTTACGACCAT
Protein sequence:
MVVTTSNAQQQLCSAQGCAALYSDSNIRTSACCAKRPGNFHECCYSSCNFGSPC
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 5715.4 | 54 | 7.52 | -0.144 | 62.16 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR018570
Pfam: PF09461
SMART:
KEGG:
PRINTS: