Effector profile
| PlantPEAD ID: PlantPEAD35771 | Uniprot ID: A0A2P4XNT7 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 611791 | Pathogen type: Oomycota |
| Species: Phytophthora palmivora | Strain: var. palmivora | Other name: |
| Gene name: | NCBI Gene ID: NCKW01009461 | |
| Entry name: A0A2P4XNT7_9STRA | Protein name: PcF and SCR74-like cys-rich secreted peptide | |
| DOI: | ||
Gene/Protein information
Gene sequence:
ATGAATTTCAAGGTTTATTTCGCTGTGGTACTTGCTACTGTGGCTGCCACGTCAATCAGTGCGCAACAGTACTGCACTGCTCAAGGTTGCGCCTACATCTATTCAGATAGCAACATAAAGACCAAAAGCGAGGCGGCAATTTCAATGAGTGCTGCCGTACCAGTTGCACATTCGGATCCCCGTGCTAGTAAGAGGGACCCCAAAGCGGCGACAACGTGA
Protein sequence:
MNFKVYFAVVLATVAATSISAQQYCTAQGCAYIYSDSNIKTKSEAAISMSAAVPVAHSDPRASKRDPKAATT
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 7576.61 | 72 | 9.06 | 0.047 | 33.64 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR018570
Pfam: PF09461
SMART:
KEGG:
PRINTS: