Effector profile
| PlantPEAD ID: PlantPEAD36988 | Uniprot ID: A0A1E1M219 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 38038 | Pathogen type: Fungi |
| Species: Rhynchosporium secalis | Strain: | Other name: |
| Gene name: | NCBI Gene ID: FJVC01000116 | |
| Entry name: A0A1E1M219_RHYSE | Protein name: Related to endoglucanase I | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKLTTFAIPAFLAATAAASPTPEAPGLVGKRPEKMCSNWGSVVTGGFTIYHNPWGASSGTGSQCTTFNSISPAGSVSWSTEWTWANGKNSVKSYSNVALEKVNKPLSAITSIPSTWSWSYTGSNMVADVAYDLWLAPTVGGANKYEIMIWLGSYGGAGPISSSYNAAGNPVPAASAIAIGGTNWDLYKGPNGDVTVFSFVAPSNQANYSGDLMAFFNYLTKSQGVPTSSVVTSLQSGTEPFTGQNAVFTTTGYTIKVI
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 26926.1 | 258 | 7.68 | 0.001 | 30.36 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR013320,IPR013319,IPR002594
Pfam: PF01670
SMART:
KEGG:
PRINTS: