Effector profile
PlantPEAD ID: PlantPEAD39963 Uniprot ID: E6ZLE4 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 72558 Pathogen type: Fungi
Species: Sporisorium reilianum Strain: strain SRZ2 Other name: Maize head smut fungus
Gene name: NCBI Gene ID: FQ311430
Entry name: E6ZLE4_SPORE Protein name: Related to stress response protein rds1p
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKLTLSFVLALAAASSATASPLVRRQQSATSALGNLPTPSAVLSSAGSIASIPTSVATRSASSASPAAPSTTAVPTPPTSPTTFNDTQILQYALTLEHLEATFYNQSLSKLSAADFEDAGYNASVRNRIYSIGRDEAAHVELLTKALGNASVPACTYSFSSVTDVPSFLTTARVLEGVGVSAYLGAAQNVTEKSALETAGSILVVEGQHQAYLIAQTNDGGNSIPSPFATPLDFKQVYSLAAPFIASCPQNASLPITAFPTLSLTGGAANGSFTPGQQVTVSYNASNTTSTANQTYLAVIQGVAGAQFVPLTSGSGSQVSLPANLTGGQMYAVVTSSNGTVTDDNTLAGPAVGYVNVPLPQAPDATSTGSASSSAASGVATATASGSDSIVSSAPASSSTGSASSAGAASTSQALAPSLASLGSANVPQPTASN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
49559.7 434 4.72 0.144 41.1
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.